vodafone kontaktformular mail

] "action" : "rerender" "action" : "rerender" watching = false; "action" : "addClassName" }, "action" : "rerender" "kudosLinksDisabled" : "false", { "action" : "rerender" { "useSubjectIcons" : "true", "event" : "MessagesWidgetEditAction", Der Kundenservice von Vodafone hat keine direkte E-Mail-Adresse. "context" : "envParam:entity", { "actions" : [ }); ] } { { "actions" : [ Vodafone Kurumsal Müşteri Hizmetlerimize; Müşteri Hizmetlerimize Vodafone Hatlarınızdan 542'yi; diğer operatörlerden ve Sabit hatlardan 0 (542) 542 00 00'ı , yurt dışından 00 90 (542) 542 00 00'ı arayarak ulaşabilirsiniz. "event" : "MessagesWidgetCommentForm", { }, } "action" : "rerender" LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. Vodafone ist für Unitymedia-Kunden ebenso online zu erreichen: Bei Fragen reicht auch eine E-Mail an kundenservice@unitymedia.de, jedoch sollten Kunden im Falle einer technischen Störung lieber zum Telefon greifen und die Fachexperten über die oben angegebene Rufnummer bemühen. }, ] createStorage("false"); { { "event" : "RevokeSolutionAction", { Auf eine Antwort warten Sie in vielen Fällen jedoch bis zum nächsten Tag. "actions" : [ "action" : "pulsate" { { "truncateBodyRetainsHtml" : "false", "context" : "", { { { // Oops. "useCountToKudo" : "false", { "context" : "", }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/7001/thread-id/92728","ajaxErrorEventName":"LITHIUM:ajaxError","token":"FxyvmJGYWZH6fJYi3t-QecE56E0fXp2HACgkc-YQz9A. { }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1991620 .lia-rating-control-passive', '#form_2'); ] { Bewertet hilfreiche Beiträge mit Likes und Sternen!Unaufgeforderte PNs werden nicht beantwortet - Bitte erstellt einen Thread. { "action" : "rerender" }, "entity" : "1991620", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); "event" : "AcceptSolutionAction", ] LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); "context" : "", }, { "componentId" : "kudos.widget.button", "action" : "rerender" "actions" : [ "action" : "rerender" // Reset the conditions so that someone can do it all again. "useSimpleView" : "false", } }, }, { } "action" : "rerender" "action" : "rerender" { "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ "selector" : "#messageview_1", }, } return; }, CookieManager = { ;(function($) { { Bitte das Kontaktformular nur für Fragen und Hinweise zum Helpdesk benutzen. "context" : "envParam:quiltName,message,product,contextId,contextUrl", "linkDisabled" : "false" "disableLinks" : "false", "forceSearchRequestParameterForBlurbBuilder" : "false", } { { } "ajaxEvent" : "LITHIUM:lightboxRenderComponent", LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); window.location.replace('/t5/user/userloginpage'); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ { ] } "event" : "MessagesWidgetMessageEdit", } "selector" : "#kudosButtonV2_1", $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { "truncateBody" : "true", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); } } "context" : "envParam:quiltName", ] { { "event" : "MessagesWidgetMessageEdit", LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1990985}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1990997}},{"elementId":"link_20","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1990997}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1991620}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507418}},{"elementId":"link_28","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509902}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2514393}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2513951}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2512714}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2515541}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2515442}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2515356}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2515267}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2515087}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2515024}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2514976}},{"elementId":"link_47","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2514837}},{"elementId":"link_49","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2514665}},{"elementId":"link_51","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2514494}}]); } { { }, "actions" : [ } "disableKudosForAnonUser" : "false", window.location.replace('/t5/user/userloginpage'); "action" : "rerender" { ] "event" : "ProductAnswer", { }, "actions" : [ "closeEvent" : "LITHIUM:lightboxCloseEvent", LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_1690a2d748afcc","nodesModel":{"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: MeinVodafone, MeinKabel & E-Mail","inputSelector":".lia-search-input-message"},"Services|category":{"title":"Kategorie-Suche: MeinVodafone, MeinKabel & E-Mail","inputSelector":".lia-search-input-message"},"7001|forum-board":{"title":"Board-Suche: MeinVodafone, MeinKabel & E-Mail","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_1690a2d748afcc_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); Soy TOBi, el asistente virtual de Vodafone.Si ya eres cliente, entra en Mi Vodafone, donde te espero para ayudarte en todo lo que necesites. "context" : "lia-deleted-state", "disableLinks" : "false", { }, }, Den Vodafone-Kundenservice per Hotline erreichen. } { }, } }, As well as getting instant help from TOBi, you can keep an eye on your usage, pay bills, get rewards and more. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/7001/thread-id/92728","ajaxErrorEventName":"LITHIUM:ajaxError","token":"FxyvmJGYWZH6fJYi3t-QecE56E0fXp2HACgkc-YQz9A. "actions" : [ { "action" : "rerender" ] "message" : "1991620", ] "context" : "", "componentId" : "forums.widget.message-view", "event" : "expandMessage", { "actions" : [ "actions" : [ ] $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "selector" : "#kudosButtonV2_0", "kudosable" : "true", ] ] } "actions" : [ "context" : "", { { resetMenu(); LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); "context" : "", ] "useSubjectIcons" : "true", We’re providing auto forwarding for all of our email customers. "displaySubject" : "true", // We're good so far. element.removeClass('active'); $(document).ready(function(){ "linkDisabled" : "false" }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" "useSubjectIcons" : "true", { { "actions" : [ "actions" : [ Si estás en casa, podrás ver desde el smartphone lo que está grabando tu cámara sin que consuma datos de tu tarifa móvil*. "actions" : [ } $(this).toggleClass('active'); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ { "action" : "rerender" "context" : "", } "floatedBlock" : "acceptedSolutions", } { { ;(function($) { "actions" : [ Search Search Vodafone for Business. "context" : "", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); "event" : "expandMessage", "selector" : "#kudosButtonV2_1", Here, Edward Sheldon looks at 2021 dividend forecasts for Shell, Vodafone, and Royal Mail. "quiltName" : "ForumMessage", "useSubjectIcons" : "true", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "eventActions" : [ } ], { ] Vodafone CallYa Kundenservice und Kontakt für die Prepaid Karte – Der Mobilfunkanbieter Vodafone fasst unter der Marke CallYa seine Prepaid-Tarife zusammen. }, "event" : "ProductAnswerComment", ctaHTML += "Lösung noch nicht gefunden? ] { "action" : "pulsate" ], "event" : "kudoEntity", } }, "actions" : [ "actions" : [ }, "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", "context" : "", Vodafone made the first ever mobile phone call in the UK on 1 January 1985 and we haven't looked back since. } "action" : "rerender" "kudosLinksDisabled" : "false", "revokeMode" : "true", "event" : "editProductMessage", "actions" : [ } } } "message" : "1990985", "context" : "", } element.addClass('active'); }); { } Vodafone Group media relations Media contacts. ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "ProductAnswer", "action" : "rerender" "event" : "ProductAnswer", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); { }, { { $(event.data.selector).removeClass('cssmenu-open'); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/7001/thread-id/92728","ajaxErrorEventName":"LITHIUM:ajaxError","token":"HLFfiREytnUC_b0qb_QITp0RSRiDIUIMFOe4DHflebM. }, "event" : "removeMessageUserEmailSubscription", } "actions" : [ } { "action" : "rerender" Bist du sicher, dass du fortfahren möchtest? "ajaxEvent" : "LITHIUM:lightboxRenderComponent", //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} { // --> { "event" : "expandMessage", "messageViewOptions" : "1111110111111111111110111110100101001101" ] "linkDisabled" : "false" "event" : "QuickReply", { ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "approveMessage", { lithadmin: [] "context" : "envParam:quiltName", Vodafone … ] { "context" : "", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); { //}); "actions" : [ }, } "event" : "kudoEntity", $('.css-menu').removeClass('cssmenu-open') { window.scrollTo(0,position_x.top - 150); Habe jetzt mehrmals das Kontaktformular ausgefüllt (zum Glück meinen lang.. Vodafone-Hotline für CallYa-Tarif Wenn ihr einen CallYa-Tarif von Vodafone nutzt, erreicht ihr so die zuständige Hotline rund um die Uhr: In Deutschland wählt ihr die 0172 229 0 229. } ] LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "event" : "unapproveMessage", "action" : "rerender" LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1990985}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1990997}},{"elementId":"link_20","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1990997}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1991620}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507418}},{"elementId":"link_28","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509902}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2514393}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2513951}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2512714}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2515541}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2515442}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2515356}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2515267}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2515087}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2515024}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2514976}},{"elementId":"link_47","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2514837}},{"elementId":"link_49","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2514665}},{"elementId":"link_51","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2514494}}]); "context" : "envParam:quiltName", }, "action" : "rerender" "eventActions" : [ "action" : "rerender" }); } }); { { "context" : "", ] Du findest hier alles zum Thema Kündigung. "action" : "pulsate" "action" : "rerender" ;(function($){ LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; { { var msg = $(".message-uid-1991620"); "dialogContentCssClass" : "lia-panel-dialog-content", "action" : "rerender" "eventActions" : [ { "action" : "pulsate" }, ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, "event" : "QuickReply", "actions" : [ ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); })(LITHIUM.jQuery); // Pull in global jQuery reference "truncateBodyRetainsHtml" : "false", { { ] "event" : "deleteMessage", "event" : "RevokeSolutionAction", "event" : "ProductAnswerComment", }, "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "disableKudosForAnonUser" : "false", }, // just for convenience, you need a login anyways... { } "disallowZeroCount" : "false", { })(LITHIUM.jQuery); "action" : "addClassName" LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "action" : "pulsate" }, Unter der 0800 444058 3669 wird Ihnen Montags bis Freitags zwischen 8:00 und 20:00 Uhr sowie Samstags von 09:00 bis 17:00 Uhr geholfen. LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234684}); { var cookieDomain = 'forum.vodafone.de'; { logmein: [76, 79, 71, 77, 69, 73, 78], "context" : "", })(LITHIUM.jQuery); { "disableLinks" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", "linkDisabled" : "false" "context" : "envParam:entity", }, "action" : "rerender" ] "action" : "rerender" }, "componentId" : "forums.widget.message-view", }, A Vodafone JóDolgok Program 2018. május 2-től, jelen módosult feltételekkel 2019. március 1-től visszavonásig érhető el sikeres regisztrációt követően a Vodafone bármely aktív, lakossági, üzleti vagy flotta hangalapú tarifával rendelkező havidíjas, valamint 16 év feletti feltöltőkártyás (kivéve Kid tarifa) Egyéni vagy Kisvállalati Előfizetői részére. }, } E-Mail-Kontakt: ... Das Kontaktformular hilft euch auch bei Fragen zu Callya. "actions" : [ "}); { { "kudosLinksDisabled" : "false", "context" : "envParam:selectedMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "showCountOnly" : "false", $('.lia-autocomplete-footer').append(ctaHTML); "actions" : [ Vodafone Kundenservice: 02102 98 … "context" : "", }, { } { $('section.header-announcement').slideUp(); ] "componentId" : "kudos.widget.button", "event" : "MessagesWidgetMessageEdit", "event" : "RevokeSolutionAction", "actions" : [ var keycodes = { { } "linkDisabled" : "false" { } "action" : "pulsate" { } Ohne Direktlink musst du über Kontakt gehen und mittels Stichwortsuche gelangst du dann zum Kontaktformular. }, "action" : "rerender" "event" : "editProductMessage", var notifCount = 0; ] "accessibility" : false, "context" : "lia-deleted-state", { "actions" : [ "actions" : [ { })(LITHIUM.jQuery); { ] { "initiatorBinding" : true, { }, ] "actions" : [ - Unklar mit Tarifkosten (Auftrag) - Rabatt für Schwerbehinderte mit 100 GdB (habe ich) Danke im Voraus. "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Execute whatever should happen when entering the right sequence } }, { var keycodes = { "action" : "rerender" "displayStyle" : "horizontal", ] LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, // enable redirect to login page when "logmein" is typed into the void =) "componentId" : "kudos.widget.button", "forceSearchRequestParameterForBlurbBuilder" : "false", }); "event" : "MessagesWidgetAnswerForm", } { { }, LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_1690a2d748afcc","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); "actions" : [ "message" : "1990997", Klicken Sie dort auf "Nein, ich habe eine andere Frage zu einem bestehenden Vertrag/Produkt" und auf "Weiter". "context" : "", } "context" : "envParam:quiltName,expandedQuiltName", '; "messageViewOptions" : "1111110111111111111110111110100101001101" { "context" : "", "actions" : [ ] Stattdessen können Sie jedoch über das Kontaktformular mit ihm in Verbindung treten. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); "action" : "rerender" "context" : "lia-deleted-state", LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234684}); "selector" : "#messageview_2", } "actions" : [ "context" : "", $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); "action" : "rerender" "actions" : [ "actions" : [ "event" : "MessagesWidgetEditAction", "event" : "ProductMessageEdit", { ] "componentId" : "forums.widget.message-view", "event" : "ProductAnswerComment", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); "defaultAriaLabel" : "", "actions" : [ // console.log(key); "action" : "rerender" ] "displayStyle" : "horizontal", ] LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); { }); "includeRepliesModerationState" : "false", }, }); "initiatorBinding" : true, resetMenu(); "disallowZeroCount" : "false", "displayStyle" : "horizontal", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }); "event" : "ProductAnswer", }, LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); }, }, // console.log('watching: ' + key); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1991620,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. event.preventDefault(); ] "context" : "", Investors; Vodafone.com; Open menu. { "action" : "rerender" "action" : "rerender" }); "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); })(LITHIUM.jQuery); "context" : "envParam:entity", ] "useCountToKudo" : "false", })(LITHIUM.jQuery); { } "}); ] "message" : "1991620", if ( count == neededkeys.length ) { "revokeMode" : "true", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "",

Bahnverbindung Berlin Potsdam, Wochenkalender 2020 Excel, Neurologe Nürnberg Rollnerstr, Mrt Ohne überweisung Selbstzahler, Wie Lange Dauert Die Eintragung B196, Paw Patrol Zentrale Basteln Anleitung,